KLF8 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04846

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all KLF8 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human KLF8 (NP_009181.2). GKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KLF8 Antibody - Azide and BSA Free

Western Blot: KLF8 AntibodyAzide and BSA Free [NBP3-04846]

Western Blot: KLF8 AntibodyAzide and BSA Free [NBP3-04846]

Western Blot: KLF8 Antibody [NBP3-04846] - Analysis of extracts of various cell lines, using KLF8 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody - Azide and BSA Free [NBP3-04846]

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody - Azide and BSA Free [NBP3-04846]

Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP3-04846] - Analysis of L929 cells using KLF8 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: KLF8 Antibody - Azide and BSA Free [NBP3-04846]

Immunocytochemistry/ Immunofluorescence: KLF8 Antibody - Azide and BSA Free [NBP3-04846]

Immunocytochemistry/Immunofluorescence: KLF8 Antibody [NBP3-04846] - Analysis of A431 cells using KLF8 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for KLF8 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KLF8

The KLF8 gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t

Alternate Names

Basic krueppel-like factor 3, basic kruppel-like factor 3, BKLF3DKFZp686O08126, DXS741, Krueppel-like factor 8, Kruppel-like factor 8, Zinc finger protein 741, ZNF741MGC138314

Gene Symbol

KLF8

Additional KLF8 Products

Product Documents for KLF8 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KLF8 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for KLF8 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KLF8 Antibody - Azide and BSA Free and earn rewards!

Have you used KLF8 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies