KLF9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10899

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KLF9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF9 (NP_001197). Peptide sequence LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KLF9 Antibody - BSA Free

Immunohistochemistry-Paraffin: KLF9 Antibody [NBP3-10899]

Immunohistochemistry-Paraffin: KLF9 Antibody [NBP3-10899]

Immunohistochemistry-Paraffin: KLF9 Antibody [NBP3-10899] - Immunohistochemical analysis of paraffin-embedded human kidney tissue.

Applications for KLF9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLF9

KLF9 is a gene that codes for a transcription factor that activates mRNA synthesis on a selective basis from genes that only contain tandem repeats of GC boxes, otherwise the gene will be suppressed, and it has a length of 244 amino acids, and amass of approximately 27 kDa. Studies have been conducted on diseases and disorders relating to this gene, including Kabuki syndrome, otosclerosis, leiomyoma, colorectal cancer, carcinoma, glioblastoma, cholesterol, thyroiditis, and leukemia. KLF9 has also been shown to have interactions with PGR, SP1, SIN3A, HDAC7, and ELAV1 in pathways such as the diurnally regulated gene pathway.

Alternate Names

basic transcription element binding protein 1, Basic transcription element-binding protein 1, BTEB1GC-box-binding protein 1, BTEBBTE-binding protein 1, Krueppel-like factor 9, Kruppel-like factor 9, Transcription factor BTEB1

Gene Symbol

KLF9

Additional KLF9 Products

Product Documents for KLF9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KLF9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLF9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLF9 Antibody - BSA Free and earn rewards!

Have you used KLF9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies