KMT2A/MLL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55237

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KMT2A/MLL Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237]

Immunocytochemistry/ Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237]

Immunocytochemistry/Immunofluorescence: KMT2A/MLL Antibody [NBP2-55237] - Staining of human cell line A-431 shows localization to nucleoplasm.
KMT2A/MLL Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: KMT2A/MLL Antibody - BSA Free [NBP2-55237]

Chromatin Immunoprecipitation-exo-Seq: KMT2A/MLL Antibody - BSA Free [NBP2-55237]

ChIP-Exo-Seq composite graph for Anti-KMT2A (NBP2-55237) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for KMT2A/MLL Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KMT2A/MLL

The MLL gene encodes a DNA-binding protein that methylates histone H3 (see MIM 601128) lys4 (H3K4) and positively regulates expression of target genes, including multiple HOX genes (see MIM 142980). MLL is a frequent target for recurrent translocations in acute leukemias that may be characterized as acute myeloid leukemia (AML; MIM 601626), acute lymphoblastic leukemia (ALL), or mixed lineage (biphenotypic) leukemia (MLL). Leukemias with translocations involving MLL possess unique clinical and biologic characteristics and are often associated with poor prognosis. MLL rearrangements are found in more than 70% of infant leukemias, whether the immunophenotype is more consistent with ALL or AML6, but are less frequent in leukemias from older children. MLL translocations are also found in approximately 10% of AMLs in adults, as well as in therapy-related leukemias, most often characterized as AML, that develop in patients previously treated with topoisomerase II inhibitors for other malignancies. More than 50 different MLL fusion partners have been identified. Leukemogenic MLL translocations encode MLL fusion proteins that have lost H3K4 methyltransferase activity. A key feature of MLL fusion proteins is their ability to efficiently transform hematopoietic cells into leukemia stem cells (Krivtsov and Armstrong, 2007 (PubMed 17957188)).(supplied by OMIM)

Alternate Names

ALL1, ALL-1MLL/GAS7, CXXC7TET1-MLL, CXXC-type zinc finger protein 7, EC 2.1.1.43, HRXFLJ11783, HTRX, HTRX1MLL-AF4 der(11) fusion protein, KMT2ACDK6/MLL fusion protein, Lysine N-methyltransferase 2A, MLL/GAS7 fusion protein, MLL/GMPS fusion protein, MLL1, MLL1A, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog), myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), Trithorax-like protein, TRX1histone-lysine N-methyltransferase MLL, Zinc finger protein HRX

Gene Symbol

KMT2A

Additional KMT2A/MLL Products

Product Documents for KMT2A/MLL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KMT2A/MLL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KMT2A/MLL Antibody - BSA Free

Customer Reviews for KMT2A/MLL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KMT2A/MLL Antibody - BSA Free and earn rewards!

Have you used KMT2A/MLL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...