KRT81 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57133

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KRT81 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AESWYRSKCEEMKATVIRHGETLRRTKEEINELN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KRT81 Antibody - BSA Free

Immunohistochemistry-Paraffin: KRT81 Antibody [NBP2-57133]

Immunohistochemistry-Paraffin: KRT81 Antibody [NBP2-57133]

Immunohistochemistry-Paraffin: KRT81 Antibody [NBP2-57133] - Staining of human hair shows strong cytoplasmic positivity in cells in cortex/medulla.

Applications for KRT81 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KRT81

KRT81 is encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix. [provided by RefSeq]

Alternate Names

ghHb1, ghHKb1, Hair keratin K2.9, hard keratin, type II, 1, Hb-1, hHAKB2-1, K81, keratin 81, Keratin, hair, basic, 1MLN 137, keratin, type II cuticular Hb1, Keratin-81, KRTHB1HB1, Metastatic lymph node 137 gene protein, MLN137, Type II hair keratin Hb1, Type-II keratin Kb21

Gene Symbol

KRT81

Additional KRT81 Products

Product Documents for KRT81 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KRT81 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KRT81 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KRT81 Antibody - BSA Free and earn rewards!

Have you used KRT81 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies