Kv9.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14145

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kv9.2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kv9.2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kv9.2 Antibody [NBP2-14145]

Immunohistochemistry-Paraffin: Kv9.2 Antibody [NBP2-14145]

Immunohistochemistry-Paraffin: Kv9.2 Antibody [NBP2-14145] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Applications for Kv9.2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv9.2

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. The KV gene family encodes more than 30 proteins that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha subunits (KV), which include the KV1, KV2, KV3, KV4 and KV9 proteins, and accessory or KV-subunits that modify the gating properties of the coexpressed KV subunits. KV9.2 is a K+ channel subunit that reduces the ion flow and regulates channel activity. It localizes to the cell membrane and, in the absence of KCNB1, KV9.2 may not reach the plasma membrane and may remain in an intracellular compartment.

Alternate Names

Delayed-rectifier K(+) channel alpha subunit 2, KIAA1144, Kv9.2, potassium voltage-gated channel subfamily S member 2, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2, Voltage-gated potassium channel subunit Kv9.2

Gene Symbol

KCNS2

Additional Kv9.2 Products

Product Documents for Kv9.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kv9.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv9.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv9.2 Antibody - BSA Free and earn rewards!

Have you used Kv9.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies