KvBeta3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83134

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KvBeta3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human KvBeta3. Peptide sequence: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KvBeta3 Antibody - BSA Free

Western Blot: KvBeta3 Antibody [NBP2-83134]

Western Blot: KvBeta3 Antibody [NBP2-83134]

Western Blot: KvBeta3 Antibody [NBP2-83134] - WB Suggested Anti-KCNAB3 Antibody Titration: 0.65ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate
Immunohistochemistry: KvBeta3 Antibody [NBP2-83134]

Immunohistochemistry: KvBeta3 Antibody [NBP2-83134]

Immunohistochemistry: KvBeta3 Antibody [NBP2-83134] - Human kidney

Applications for KvBeta3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KvBeta3

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels. (provided by RefSeq)

Alternate Names

AKR6A9, K(+) channel subunit beta-3, KCNA3.1B, KCNA3BK+ channel beta-3 subunit, KV-BETA-3, MGC116886, potassium channel, voltage-dependent, beta-3 subunit, potassium voltage-gated channel, shaker-related subfamily, beta member 3, voltage-gated potassium channel subunit beta-3

Gene Symbol

KCNAB3

Additional KvBeta3 Products

Product Documents for KvBeta3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KvBeta3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KvBeta3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KvBeta3 Antibody - BSA Free and earn rewards!

Have you used KvBeta3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies