L3MBTL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68865

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all L3MBTL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for L3MBTL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: L3MBTL1 Antibody [NBP2-68865]

Immunocytochemistry/ Immunofluorescence: L3MBTL1 Antibody [NBP2-68865]

Immunocytochemistry/Immunofluorescence: L3MBTL1 Antibody [NBP2-68865] - Staining of human cell line HaCaT shows localization to nucleus.

Applications for L3MBTL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: L3MBTL1

L3MBTL1 encodes the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. This gene product is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

dJ138B7.3, FLJ41181, H-l(3)mbt, H-l(3)mbt protein, KIAA0681L3MBTLDKFZp586P1522, l(3)mbt (Drosophila)-like, L(3)mbt protein homolog, L(3)mbt-like, l(3)mbt-like (Drosophila), l(3)mbt-like 1 (Drosophila), L3MBT, lethal (3) malignant brain tumor l(3), lethal(3)malignant brain tumor-like protein

Gene Symbol

L3MBTL1

Additional L3MBTL1 Products

Product Documents for L3MBTL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for L3MBTL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for L3MBTL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review L3MBTL1 Antibody - BSA Free and earn rewards!

Have you used L3MBTL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies