Laminin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34181

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Laminin Antibody was made to a recombinant protein corresponding to amino acids: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

337 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Laminin Antibody - BSA Free

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181] - Staining of human testis with Laminin Antibody [NBP2-34181] shows membranous positivity in basal membrane of seminiferous ducts.
Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181] - Staining of human placenta with Laminin Antibody [NBP2-34181] shows membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181]

Immunohistochemistry-Paraffin: Laminin Antibody [NBP2-34181] - Staining of human skin with Laminin Antibody [NBP2-34181] shows membranous positivity in stratum basale.

Applications for Laminin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Laminin

Laminin, the most abundant structural and biologically active component in basement membranes, is a complex extracellular glycoprotein with high molecular weight (900 kDa). Laminin is composed of a laminin alpha (400 kDa), beta (215 kDa) and gamma chain (205 kDa), whose multidomain proteins are encoded by distinct genes (LAMA, LAMB, LAMC respectively) and have several isoforms of each chain. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, reflecting diverse functions in vivo. Laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Laminins are an important and biologically active part of the basal lamina, influencing cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis, where anti-laminin antibodies can be widely used to label blood vessels and basement membranes (1). Significant quantities of laminin are found in basement membranes, the thin extracellular matrices that surround epithelial tissue, nerve, fat cells and smooth, striated and cardiac muscle. Excessive serum laminin levels have been associated with fibrosis, cirrhosis and hepatitis, serious and frequent complications of chronic active liver disease characterized by excessive deposition of various normal components of connective tissue in liver (2). Epithelial mesenchymal transition (EMT) biomarkers include fibronectin, laminin, N-cadherin, and Slug (3).

References

1. Yang, M. Y., Chiao, M. T., Lee, H. T., Chen, C. M., Yang, Y. C., Shen, C. C., & Ma, H. I. (2015). An innovative three-dimensional gelatin foam culture system for improved study of glioblastoma stem cell behavior. J Biomed Mater Res B Appl Biomater, 103(3), 618-628. doi:10.1002/jbm.b.33214

2. Mak, K. M., & Mei, R. (2017). Basement Membrane Type IV Collagen and Laminin: An Overview of Their Biology and Value as Fibrosis Biomarkers of Liver Disease. Anat Rec (Hoboken), 300(8), 1371-1390. doi:10.1002/ar.23567

3. Choi, S., Yu, J., Park, A., Dubon, M. J., Do, J., Kim, Y.,... Park, K. S. (2019). BMP-4 enhances epithelial mesenchymal transition and cancer stem cell properties of breast cancer cells via Notch signaling. Sci Rep, 9(1), 11724. doi:10.1038/s41598-019-48190-5

Alternate Names

LAMA, Laminin A chain, laminin subunit alpha-1, laminin, alpha 1, Laminin-1 subunit alpha, Laminin-3 subunit alpha, PTBHS, S-LAM alpha, S-laminin subunit alpha

Gene Symbol

LAMA1

UniProt

Additional Laminin Products

Product Documents for Laminin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Laminin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Laminin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Laminin Antibody - BSA Free and earn rewards!

Have you used Laminin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Laminin Antibody - BSA Free

Showing  1 - 4 of 4 FAQs Showing All
  • Q: I'm looking for a basement membrane marker, can you suggest a Laminin antibody that can be used for this purpose?

    A: The following Laminin antibodies are Basement Membrane markers: NB120-17107, NB300-144, NB600-883, and NBP1-51759.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What is the theoretical molecular weight for your Laminin antibodies?

    A: The theoretical molecular weight for Laminin antibodies is 337 kDa.

  • Q: What research areas can this product be used in?

    A: All Laminin products can be used in: Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors.

  • Q: I'm looking for a basement membrane marker, can you suggest a Laminin antibody that can be used for this purpose?

    A: The following Laminin antibodies are Basement Membrane markers: NB120-17107, NB300-144, NB600-883, and NBP1-51759.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What is the theoretical molecular weight for your Laminin antibodies?

    A: The theoretical molecular weight for Laminin antibodies is 337 kDa.

  • Q: What research areas can this product be used in?

    A: All Laminin products can be used in: Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors.

  • Q: I'm looking for a basement membrane marker, can you suggest a Laminin antibody that can be used for this purpose?

    A: The following Laminin antibodies are Basement Membrane markers: NB120-17107, NB300-144, NB600-883, and NBP1-51759.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What is the theoretical molecular weight for your Laminin antibodies?

    A: The theoretical molecular weight for Laminin antibodies is 337 kDa.

  • Q: What research areas can this product be used in?

    A: All Laminin products can be used in: Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors.

  • Q: I'm looking for a basement membrane marker, can you suggest a Laminin antibody that can be used for this purpose?

    A: The following Laminin antibodies are Basement Membrane markers: NB120-17107, NB300-144, NB600-883, and NBP1-51759.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: If any of our primary antibodes are used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product. Please check out our Innovator's Reward Program if you decide to test an antibody with a species or application that is not currently listed.

  • Q: What is the theoretical molecular weight for your Laminin antibodies?

    A: The theoretical molecular weight for Laminin antibodies is 337 kDa.

  • Q: What research areas can this product be used in?

    A: All Laminin products can be used in: Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors.

Showing  1 - 4 of 4 FAQs Showing All
View all FAQs for Antibodies
Loading...