Laminin beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35175

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Laminin beta 3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 762-1004 of human Laminin beta 3 (NP_000219.2).

Sequence:
QQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYGEWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRPNARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

130 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Laminin beta 3 Antibody - BSA Free

Laminin beta 3 Antibody

Western Blot: Laminin beta 3 Antibody [NBP3-35175] -

Western Blot: Laminin beta 3 Antibody [NBP3-35175] - Western blot analysis of lysates from HeLa cells, using Laminin beta 3 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for Laminin beta 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Laminin beta 3

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Alternate Names

BM600-125kDa, Epiligrin subunit bata, FLJ99565, Kalinin B1 chain, Kalinin subunit beta, kalinin-140kDa, LAM5, Laminin 5, Laminin B1k chain, laminin S B3 chain, laminin subunit beta-3, laminin, beta 3, laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)), Laminin-5 subunit beta, LAMNB1, Nicein subunit beta, nicein-125kDa

Gene Symbol

LAMB3

Additional Laminin beta 3 Products

Product Documents for Laminin beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Laminin beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Laminin beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Laminin beta 3 Antibody - BSA Free and earn rewards!

Have you used Laminin beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies