LARP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38102

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LARP1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).

Sequence:
AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LARP1 Antibody - BSA Free

LARP1 Antibody

Western Blot: LARP1 Antibody [NBP3-38102] -

Western Blot: LARP1 Antibody [NBP3-38102] - Western blot analysis of various lysates using LARP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.

Applications for LARP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LARP1

LARP1 (la-related protein 1) is part of a family of proteins that bears a La motif. The La motif was first identified in the La protein which was isolated as an autoreactive antigen in patients afflicted with systemic lupus erythematosus. Like the La protein, LARP proteins appear to be RNA-binding proteins, and are proposed to play a role in translation elongation and termination. Alternative names for LARP1 include la ribonucleoprotein domain family member 1, LARP, and KIAA0731.

Alternate Names

KIAA0731LARPMGC19556, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family, member 1, la-related protein 1

Gene Symbol

LARP1

Additional LARP1 Products

Product Documents for LARP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LARP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LARP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LARP1 Antibody - BSA Free and earn rewards!

Have you used LARP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies