LCMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56384

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LCMT2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LCMT2 Antibody - BSA Free

Western Blot: LCMT2 Antibody [NBP2-56384]

Western Blot: LCMT2 Antibody [NBP2-56384]

Western Blot: LCMT2 Antibody [NBP2-56384] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: LCMT2 Antibody [NBP2-56384]

Immunocytochemistry/ Immunofluorescence: LCMT2 Antibody [NBP2-56384]

Immunocytochemistry/Immunofluorescence: LCMT2 Antibody [NBP2-56384] - Staining of human cell line HeLa shows localization to nucleoplasm & vesicles.

Applications for LCMT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LCMT2

LCMT2 is encoded by this intronless gene belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

Alternate Names

EC 2.1.1.-, FLJ51321, KIAA0547tRNA-Wybutosine-synthesizing protein 4, leucine carboxyl methyltransferase 2, MGC9534, p21WAF1/CIP1 promoter-interacting protein, PPM2, tRNA wybutosine-synthesizing protein 4 homolog, tRNA yW-synthesizing protein 4 homolog, TYW4tRNA-yW synthesizing protein 4

Gene Symbol

LCMT2

Additional LCMT2 Products

Product Documents for LCMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LCMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LCMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LCMT2 Antibody - BSA Free and earn rewards!

Have you used LCMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies