LETMD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57582

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LETMD1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LETMD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LETMD1 Antibody [NBP2-57582]

Immunocytochemistry/ Immunofluorescence: LETMD1 Antibody [NBP2-57582]

Immunocytochemistry/Immunofluorescence: LETMD1 Antibody [NBP2-57582] - Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for LETMD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LETMD1

LETMD1, also known as LETM1 domain-containing protein 1, is a protein with 7 isoforms ranging from 99 amino acid and 11 kDa to 373 amino acid and 43 kDa; localizes in mitochondrion outer membrane; commonly found in kidney, liver, skeletal muscle, heart and brain; has a potential role in tumor genesis, which may result from negative regulation of the p53 tumor suppressor gene. Studies are being performed in relation to this protein and wolf-Hirsch horn syndrome, cervical cancer, cervicitis, breast cancer, leukemia/lymphoma, polyposis, pancreatic cancer, obesity, pancreatitis, leukemia, and carcinoma. This protein has been shown to interact with REEP5 protein.

Alternate Names

1110019O13Rik, cervical cancer 1 protooncogene, Cervical cancer 1 proto-oncogene protein p40, Cervical cancer proto-oncogene 2 protein, DKFZp586A011, HCCR1, HCCR-1, HCCR-2, HCRR-2, LETM1 domain containing 1, LETM1 domain-containing protein 1, regulator of TP53

Gene Symbol

LETMD1

Additional LETMD1 Products

Product Documents for LETMD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LETMD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LETMD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LETMD1 Antibody - BSA Free and earn rewards!

Have you used LETMD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies