LHPP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-83273
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Predicted:
Rat (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGE
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 29562234).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LHPP Antibody - BSA Free
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-LHPP antibody (A) NBP1-83273 shows similar protein distribution across tissues to independent antibody NBP1-83272 (B).Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons and glial cells.Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.Immunohistochemistry: LHPP Antibody [NBP1-83273] -
nbp1-83273_rabbit-polyclonal-lhpp-antibody-2552023151490.jpgImmunohistochemistry: LHPP Antibody [NBP1-83273] -
Immunohistochemistry: LHPP Antibody [NBP1-83273] - METTL14-mediated m6A modification represses LHPP expression in GC.A The potential m6A sites were predicted by SRAMP. B, C qRT-PCR & western blot assays revealed the mRNA & protein expression, respectively, of LHPP in GC cells with knockdown or overexpression of METTL14. D IHC staining of LHPP & METTL14 in TMAs. Scale bars = 200 μm. E m6A immunoprecipitation & qRT-PCR assays showed the relative percentage of LHPP mRNA with methylation. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, ns no significant difference, GC gastric cancer, qRT-PCR quantitative reverse transcription-polymerase chain reaction, IHC immunohistochemical, TMS tissue microarrays. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: LHPP Antibody [NBP1-83273] -
Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP inhibits GC proliferation & metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 & KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays & colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays & colony formation. F Transwell assays with stably transfected HGC-27 & MGC-803 cells were performed. Representative images & quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: LHPP Antibody [NBP1-83273] -
Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP suppresses aerobic glycolysis.A Relative mRNA expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells by qPCR. B Protein expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. C IHC staining of LHPP & HIF1A in TMAs & their correlation. Scale bars = 100 μm. D Oxygen consumption rate & extracellular acidification rate of LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells were measured using the Seahorse Bioscience XF96 analyser. E Human phosphokinase microarray assay analysis of the conditioned medium from stably transfected HGC-27 cells. A summary of the relative signal intensities of the indicated proteins is shown. G, H IHC staining of LHPP & p-GSK3b in TMAs & their correlation. Scale bars = 200 μm. F Combined LHPP & GSK3b by co-immunoprecipitation. I Protein expression levels of the Wnt pathway in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, KEGG Kyoto encyclopaedia of genes & genomes, GO gene ontology, qPCR quantitative polymerase chain reaction, IHC immunohistochemical, TMA tissue microarray. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -
LHPP inhibits GC proliferation and metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 and KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays and colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays and colony formation. F Transwell assays with stably transfected HGC-27 and MGC-803 cells were performed. Representative images and quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -
LHPP inhibits GC proliferation and metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 and KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays and colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays and colony formation. F Transwell assays with stably transfected HGC-27 and MGC-803 cells were performed. Representative images and quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -
Expression and prognostic value of LHPP in GC.A Flowchart of the screening process of candidate genes. B mRNA levels of LHPP in gastric tumours and adjacent normal tissues were measured by qRT-PCR. C LHPP protein levels in gastric tumours and adjacent normal tissues were measured by western blot. D Representative images of LHPP protein levels in gastric tumours and adjacent normal tissues. E Expression of LHPP in 123 paraffin-embedded specimens from the internal cohort was determined by TMA-based IHC staining. Scale bars = 200 μm. F LHPP IHC score of gastric tumours and adjacent normal tissues in Fig. 1F. Data were presented as the mean +/- SD and were analysed using Student’s t-test. G Kaplan–Meier analyses the correlations between LHPP expression and overall survival in the internal cohort. H Kaplan–Meier analyses the correlations between ACT and overall survival in the internal cohort stratified by LHPP expression. I Kaplan–Meier analyses the correlations between LHPP expression and overall survival in the external cohort. J Kaplan–Meier analyses the correlations between ACT and overall survival in the external cohort stratified by LHPP expression. P values for all survival analyses were calculated using the log-rank test. ***P < 0.001, GC gastric cancer, qRT-PCR quantitative reverse transcription-polymerase chain reaction, TMA tissue microarray, IHC immunohistochemistry, ACT adjuvant chemotherapy, Non-ACT not receiving adjuvant chemotherapy. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LHPP Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LHPP
Alternate Names
FLJ44846, HDHD2B, hLHPP, MGC117251, MGC142189, MGC142191, phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Gene Symbol
LHPP
Additional LHPP Products
Product Documents for LHPP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LHPP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for LHPP Antibody - BSA Free
Customer Reviews for LHPP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LHPP Antibody - BSA Free and earn rewards!
Have you used LHPP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...