LHPP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83273

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGE

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29562234).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LHPP Antibody - BSA Free

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding LHPP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-LHPP antibody (A) NBP1-83273 shows similar protein distribution across tissues to independent antibody NBP1-83272 (B).
Western Blot: LHPP Antibody [NBP1-83273]

Western Blot: LHPP Antibody [NBP1-83273]

Western Blot: LHPP Antibody [NBP1-83273] - Analysis in human cell lines A-431 and Caco-2 using anti-LHPP antibody. Corresponding LHPP RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons and glial cells.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273]

Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83273] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
LHPP Antibody

Immunohistochemistry: LHPP Antibody [NBP1-83273] -

nbp1-83273_rabbit-polyclonal-lhpp-antibody-2552023151490.jpg
LHPP Antibody

Immunohistochemistry: LHPP Antibody [NBP1-83273] -

Immunohistochemistry: LHPP Antibody [NBP1-83273] - METTL14-mediated m6A modification represses LHPP expression in GC.A The potential m6A sites were predicted by SRAMP. B, C qRT-PCR & western blot assays revealed the mRNA & protein expression, respectively, of LHPP in GC cells with knockdown or overexpression of METTL14. D IHC staining of LHPP & METTL14 in TMAs. Scale bars = 200 μm. E m6A immunoprecipitation & qRT-PCR assays showed the relative percentage of LHPP mRNA with methylation. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, ns no significant difference, GC gastric cancer, qRT-PCR quantitative reverse transcription-polymerase chain reaction, IHC immunohistochemical, TMS tissue microarrays. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LHPP Antibody

Immunohistochemistry: LHPP Antibody [NBP1-83273] -

Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP inhibits GC proliferation & metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 & KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays & colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays & colony formation. F Transwell assays with stably transfected HGC-27 & MGC-803 cells were performed. Representative images & quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LHPP Antibody

Immunohistochemistry: LHPP Antibody [NBP1-83273] -

Immunohistochemistry: LHPP Antibody [NBP1-83273] - LHPP suppresses aerobic glycolysis.A Relative mRNA expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells by qPCR. B Protein expression levels of glycolytic genes & glutamine transporters in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. C IHC staining of LHPP & HIF1A in TMAs & their correlation. Scale bars = 100 μm. D Oxygen consumption rate & extracellular acidification rate of LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells were measured using the Seahorse Bioscience XF96 analyser. E Human phosphokinase microarray assay analysis of the conditioned medium from stably transfected HGC-27 cells. A summary of the relative signal intensities of the indicated proteins is shown. G, H IHC staining of LHPP & p-GSK3b in TMAs & their correlation. Scale bars = 200 μm. F Combined LHPP & GSK3b by co-immunoprecipitation. I Protein expression levels of the Wnt pathway in LHPP-overexpressing or LHPP-knockdown MGC-803 cells & control cells on western blot. Data were analyzed using the Wilcoxon test. *P < 0.05, **P < 0.01, ***P < 0.001, KEGG Kyoto encyclopaedia of genes & genomes, GO gene ontology, qPCR quantitative polymerase chain reaction, IHC immunohistochemical, TMA tissue microarray. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LHPP Antibody - BSA Free

Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -

LHPP inhibits GC proliferation and metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 and KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays and colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays and colony formation. F Transwell assays with stably transfected HGC-27 and MGC-803 cells were performed. Representative images and quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LHPP Antibody - BSA Free

Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -

LHPP inhibits GC proliferation and metastasis in vitro.A Basic protein expression of LHPP in GC cell lines (MKN-28, AGS, SNU-216, MGC-803, BGC, MKN-45, HGC-27 and KATO III) was detected by western blotting. B HGC-27 cells with stable LHPP overexpression or MGC-803 cells with LHPP knockdown were created. The changes in LHPP expression were confirmed using western blotting. C, D The proliferative ability of stably transfected HGC-27 or MGC-803 cells was investigated via CCK-8 assays and colony formation. CCK-8 data were analyzed using a two-way analysis of variance. Colony number data were analyzed using the Wilcoxon test. Scale bars = 1 cm. E The drug resistance of stably transfected HGC-27 or MGC-803 cells was investigated via IC50 assays and colony formation. F Transwell assays with stably transfected HGC-27 and MGC-803 cells were performed. Representative images and quantification of the results are presented. Scale bars = 100 μm. Cell number data were analyzed using the Wilcoxon test. ***P < 0.001, GC gastric cancer, OXA Oxaliplatin. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LHPP Antibody - BSA Free

Western Blot: LHPP Antibody - BSA Free [NBP1-83273] -

Expression and prognostic value of LHPP in GC.A Flowchart of the screening process of candidate genes. B mRNA levels of LHPP in gastric tumours and adjacent normal tissues were measured by qRT-PCR. C LHPP protein levels in gastric tumours and adjacent normal tissues were measured by western blot. D Representative images of LHPP protein levels in gastric tumours and adjacent normal tissues. E Expression of LHPP in 123 paraffin-embedded specimens from the internal cohort was determined by TMA-based IHC staining. Scale bars = 200 μm. F LHPP IHC score of gastric tumours and adjacent normal tissues in Fig. 1F. Data were presented as the mean +/- SD and were analysed using Student’s t-test. G Kaplan–Meier analyses the correlations between LHPP expression and overall survival in the internal cohort. H Kaplan–Meier analyses the correlations between ACT and overall survival in the internal cohort stratified by LHPP expression. I Kaplan–Meier analyses the correlations between LHPP expression and overall survival in the external cohort. J Kaplan–Meier analyses the correlations between ACT and overall survival in the external cohort stratified by LHPP expression. P values for all survival analyses were calculated using the log-rank test. ***P < 0.001, GC gastric cancer, qRT-PCR quantitative reverse transcription-polymerase chain reaction, TMA tissue microarray, IHC immunohistochemistry, ACT adjuvant chemotherapy, Non-ACT not receiving adjuvant chemotherapy. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35568711), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for LHPP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LHPP

Alternate Names

FLJ44846, HDHD2B, hLHPP, MGC117251, MGC142189, MGC142191, phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Gene Symbol

LHPP

Additional LHPP Products

Product Documents for LHPP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LHPP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LHPP Antibody - BSA Free

Customer Reviews for LHPP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LHPP Antibody - BSA Free and earn rewards!

Have you used LHPP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...