LIS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87769

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LIS1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LIS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.
Western Blot: LIS1 Antibody [NBP1-87769]

Western Blot: LIS1 Antibody [NBP1-87769]

Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769]

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769]

Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769]

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769]

Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769]

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human cerebellum shows moderate positivity in neuropil.

Applications for LIS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. LIS1 antibody validated for ICC/IF, WB from verified customer reviews.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-87769 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIS1

Lissencephaly (LIS), literally meaning smooth brain, has multiple causes. Agyria, i.e., brain without convolutions or gyri, was considered a rare malformation until recent progress in neuroradiology. With this technical advantage, a number of lissencephaly syndromes have been distinguished. Classic lissencephaly (type I) is a brain malformation caused by abnormal neuronal migration at 9 to 13 weeks' gestation, resulting in a spectrum of agyria, mixed agyria / pachygyria, and pachygyria. It is characterized by an abnormally thick and poorly organized cortex with 4 primitive layers, diffuse neuronal heterotopia, enlarged and dysmorphic ventricles, and often hypoplasia of the corpus callosum. Lissencephaly is found in association with facial abnormalities in Miller-Dieker syndrome and without other major anomalies in X-linked lissencephaly and isolated lissencephaly sequence (ILS). Subcortical band heterotopia (SBH) are bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface and comprise the less severe end of the lissencephaly spectrum of malformations.

Alternate Names

LIS-1, LIS1PAF-AH alpha, LIS2, lissencephaly 1 protein, Lissencephaly-1 protein, MDCR, MDS, Miller-Dieker syndrome chromosome region, PAF acetylhydrolase 45 kDa subunit, PAFAH, PAF-AH 45 kDa subunit, PAFAH alpha, PAFAHA, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa), platelet-activating factor acetylhydrolase IB subunit alpha, platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD), platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Gene Symbol

PAFAH1B1

Additional LIS1 Products

Product Documents for LIS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LIS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LIS1 Antibody - BSA Free

Customer Reviews for LIS1 Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used LIS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: Caco-2 cells
    Species: Human
    Verified Customer | Posted 03/25/2015
    LIS1 Immunoflourescence picture
    LIS1 Antibody - BSA Free NBP1-87769
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Caco-2 whole cell lysate
    Species: Human
    Verified Customer | Posted 03/23/2015
    LIS1 - Western Blot
    LIS1 Antibody - BSA Free NBP1-87769

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies