Livin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56859

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Livin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Livin Antibody [NBP2-56859]

Immunocytochemistry/ Immunofluorescence: Livin Antibody [NBP2-56859]

Immunocytochemistry/Immunofluorescence: Livin Antibody [NBP2-56859] - Staining of human cell line U-2 OS shows localization to nucleus & microtubule organizing center.

Applications for Livin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Livin

Livin (BIRC7/KIAP) is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain (reviewed in Ma et al 2006 and Crnkovic-Mertens et al 2006). Resistance towards apoptosis is a hallmark of cancer cells, and overexpression of IAPs can contribute to the development of cancer though inhibiting apoptosis (reviewed in Wright et al. 2005). IAP proteins inhibit apoptosis by binding to and inhibiting caspases through their BIR domain(s). Some IAP members, like Liven, also have a RING-type finger motif at their carboxyl-terminal which may enhance anti-apoptotic activity. Many RING finger-containing IAPs possess E3 ubiquitin ligase activity, and it has been shown that Liven acts an E3 ubiquitin ligase for targeting the degradation of Smac/DIABLO. Smac/DIABLO functions by inhibiting IAP-caspase interactions, thereby promoting apoptosis. Thus degradation of Smac/DIABLO is thought to be a mechanism to enhance Livin anti-apoptotic activity, thereby promoting cell survival. Two splicing variants of Livin, alpha and beta, have been identified. The two isoforms are thought to have different anti-apoptotic properties; however, there are conflicting reports are to whether they actually differ in their biological activities. There is accumulating evidence that Liven plays a significant role in a spectrum of tumor types and it is thought that Liven may have potential as a diagnostic and prognostic tumor marker. Liven is expressed at low levels in adult tissues, and relatively higher levels in developmental tissues and in many cancer cells. Certain cancer patients develop autoantibodies against liven and in a number of cancers, Liven is detected only in the tumors but not, or to substantially lower levels, in the corresponding normal adjacent tissue. This antibody recognizes Livin, both isoform alpha and isoform beta. Human Livin isoform alpha is a 298 amino acid (aa) protein, GenBank no. NP_647478. Human Livin isoform beta is a 280 aa protien, GenBank no. NP_071444.1. The antibody will also recognize other isoforms of Livin that contain the peptide immunogen sequence.

Alternate Names

BIRC7, KIAP, ML-IAP

Gene Symbol

BIRC7

Additional Livin Products

Product Documents for Livin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Livin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Livin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Livin Antibody - BSA Free and earn rewards!

Have you used Livin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Apoptosis Signaling Pathway
Apoptosis Signaling Pathway Thumbnail