LMO4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49342

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LMO4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit LMO4 Antibody - BSA Free (NBP2-49342) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for LMO4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LMO4 Antibody [NBP2-49342]

Immunocytochemistry/ Immunofluorescence: LMO4 Antibody [NBP2-49342]

Immunocytochemistry/Immunofluorescence: LMO4 Antibody [NBP2-49342] - Staining of human cell line SiHa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342]

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342]

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
LMO4 Antibody

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] -

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neurons.
LMO4 Antibody

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] -

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
LMO4 Antibody

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] -

Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for LMO4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMO4

The LIM-only (LMO) proteins, LMO1 and LMO2, are nuclear factors that are characterized by a conserved LIM domain. The LIM domain consists of a cysteine-rich zinc-binding motif that is present in a variety of transcription factors, including the LIM homeobox (LHX) proteins expressed in the central nervous system and involved in cell differentiation. LMO1 and LMO2 are expressed in the adult CNS in a cell type-specific manner, where they are differentially regulated by neuronal activity and are involved in regulating the cellular differentiated phenotype of neurons. LMO2 lacks a specific DNA-binding homeobox domain but rather assembles into transcriptional regulatory complexes to mediate gene expression by interacting with the widely expressed nuclear LIM interactor (NLI). NLI, known also as CLIM-1, and the related protein CLIM-2 facilitate the formation of heteromeric LIM complexes and also enhance the nuclear retention of LIM proteins. LMO2 and the related protein LMO4 are expressed in thymic precursor cells. LMO4 is also expressed in mature T cells, cranial neural crest cells, somite, dorsal limb bud mesenchyme, motor neurons, and Schwann cell progenitors.

Long Name

LIM Domain Only 4

Alternate Names

Crp3, Etohi4

Gene Symbol

LMO4

Additional LMO4 Products

Product Documents for LMO4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LMO4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMO4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMO4 Antibody - BSA Free and earn rewards!

Have you used LMO4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies