LMP2/PSMB9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55229

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG

Reactivity Notes

Mouse 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMP2/PSMB9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LMP2/PSMB9 Antibody [NBP2-55229]

Immunocytochemistry/ Immunofluorescence: LMP2/PSMB9 Antibody [NBP2-55229]

Immunocytochemistry/Immunofluorescence: LMP2/PSMB9 Antibody [NBP2-55229] - Staining of human cell line U-2 OS shows localization to cytosol.

Applications for LMP2/PSMB9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMP2/PSMB9

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. LMP2 is a catalytic subunit of the 20S proteasome and, upon interferon gamma-induction, replaces the delta subunit. LMP2 alters the specificity of the 20S proteasome and is critical for the production of MHC class I ligands, production of T-lymphocytes, and is suggested to increase the efficiency of antigen presentation of the immune response. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelman's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 9

Alternate Names

Proteasome subunit beta-1i, PSMB9, RING12

Gene Symbol

PSMB9

Additional LMP2/PSMB9 Products

Product Documents for LMP2/PSMB9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LMP2/PSMB9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for LMP2/PSMB9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMP2/PSMB9 Antibody - BSA Free and earn rewards!

Have you used LMP2/PSMB9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...