LMP2/PSMB9 Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-71534

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all LMP2/PSMB9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for LMP2/PSMB9 Antibody [Biotin]

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: LMP2/PSMB9

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. LMP2 is a catalytic subunit of the 20S proteasome and, upon interferon gamma-induction, replaces the delta subunit. LMP2 alters the specificity of the 20S proteasome and is critical for the production of MHC class I ligands, production of T-lymphocytes, and is suggested to increase the efficiency of antigen presentation of the immune response. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelman's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 9

Alternate Names

Proteasome subunit beta-1i, PSMB9, RING12

Gene Symbol

PSMB9

Additional LMP2/PSMB9 Products

Product Documents for LMP2/PSMB9 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LMP2/PSMB9 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

T Cell Antigen Recognition

Customer Reviews for LMP2/PSMB9 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review LMP2/PSMB9 Antibody [Biotin] and earn rewards!

Have you used LMP2/PSMB9 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies