LPCAT2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88921
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPE
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:32140075).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit LPCAT2 Antibody - BSA Free (NBP1-88921) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LPCAT2 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for LPCAT2 Antibody - BSA Free
Western Blot: LPCAT2 Antibody [NBP1-88921]
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunocytochemistry/ Immunofluorescence: LPCAT2 Antibody [NBP1-88921]
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of human cell line A-431 shows localization to endoplasmic reticulum & lipid droplets.Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland and skeletal muscle tissues using NBP1-88921 antibody. Corresponding LPCAT2 RNA-seq data are presented for the same tissues.Western Blot: LPCAT2 Antibody [NBP1-88921]
Western Blot: LPCAT2 Antibody [NBP1-88921] - Analysis in human thyroid gland tissue.Immunocytochemistry/ Immunofluorescence: LPCAT2 Antibody [NBP1-88921]
Immunocytochemistry/Immunofluorescence: LPCAT2 Antibody [NBP1-88921] - Staining of murine cell line RAW264.7. Image provided by product review by verified customer.Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Frozen: LPCAT2 Antibody [NBP1-88921] - Staining of LPCAT2 in rat neuronal tissue using anti-LPCAT2 antibody. Image from verified customer review.Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human skeletal muscle shows very weak positivity in myocytes.Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human small intestine shows weak membranous positivity in glandular cells.Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human testis shows weak granular cytoplasmic positivity in Leydig cells.Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921]
Immunohistochemistry-Paraffin: LPCAT2 Antibody [NBP1-88921] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.Applications for LPCAT2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Frozen
Validated from verified customer review
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Reviewed Applications
Read 2 reviews rated 4.5 using NBP1-88921 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LPCAT2
Long Name
Lysophosphatidylcholine Acyltransferase 2
Alternate Names
AGPAT11, AYTL1, LPCAT-2
Gene Symbol
LPCAT2
Additional LPCAT2 Products
Product Documents for LPCAT2 Antibody - BSA Free
Product Specific Notices for LPCAT2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for LPCAT2 Antibody - BSA Free
Customer Reviews for LPCAT2 Antibody - BSA Free (2)
4.5 out of 5
2 Customer Ratings
Have you used LPCAT2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: Rat neuronal tissueSpecies: RatVerified Customer | Posted 02/20/2015LPCAT2 staining in rat tissue
-
Application: ImmunocytochemistrySample Tested: RAW264.7 cellsSpecies: MouseVerified Customer | Posted 02/12/2013RAW264.7 cells on mouse tissue
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for LPCAT2 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: Do you have an estimated band size for the LPCAT2 antibody (NBP1-88921) for Western blotting?
A: According to Uniprot, human LPCAT2 has a predicted molecular weight of approximately 60kDa. Please see UniProt entry Q7L5N7.
Loading...