LPCAT3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04752

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human LPCAT3 (NP_005759.4). GPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LPCAT3 Antibody - Azide and BSA Free

LPCAT3 Antibody - Azide and BSA Free

Western Blot: LPCAT3 Antibody [NBP3-04752] -

Western Blot: LPCAT3 Antibody [NBP3-04752] - nalysis of lysates from HepG2 cells, using LPCAT3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit Exposure time: 30s.
LPCAT3 Antibody - Azide and BSA Free

IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free-

IHC-P-NBP3-04752-LPCAT3 Antibody - Azide and BSA Free- Analysis of LPCAT3 in paraffin-embedded rat kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
LPCAT3 Antibody - Azide and BSA Free

Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] -

Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
LPCAT3 Antibody - Azide and BSA Free

Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] -

Immunohistochemistry: LPCAT3 Antibody - Azide and BSA Free [LPCAT3] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using LPCAT3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for LPCAT3 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 -1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LPCAT3

Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle

Alternate Names

1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.n6, LPCAT, LPLAT 5, Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine acyltransferase 3LPSAT, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 5, Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase domain-containing protein 5, NESSY, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, putative protein similar to nessy

Gene Symbol

LPCAT3

Additional LPCAT3 Products

Product Documents for LPCAT3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LPCAT3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for LPCAT3 Antibody - Azide and BSA Free

Customer Reviews for LPCAT3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LPCAT3 Antibody - Azide and BSA Free and earn rewards!

Have you used LPCAT3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...