LRRC32/GARP Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-68740
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Rat
Predicted:
Mouse (94%). Backed by our 100% Guarantee.
Applications
Validated:
Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 31198639).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LRRC32/GARP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740]
Immunocytochemistry/Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Staining of human cell line U-2197 shows localization to vesicles and nucleus. Antibody staining is shown in green.Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] -
Immunocytochemistry/ Immunofluorescence: LRRC32/GARP Antibody [NBP2-68740] - Immunofluorescent staining experiment.For immunofluorescent staining experiment, we used GARP antibody to show the expression of GARP protein, homologous anti-IgG antibody as isotype control & DAPI to show the location of nucleus. GARP, Glycoprotein A repetitions predominant; DAPI, diamidino-phenyl-indole. (A) & (D) showed the merge image of two groups; (B) & (E) showed the FITC immunofluorescent staining; (C) & (F) showed the DAPI staining; 200X; Bar = 50 µm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31198639), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LRRC32/GARP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
ICC/IF, Fixation/Permeabilization: PFA/Triton X-100
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LRRC32/GARP
Long Name
Leucine-rich Repeat Containing 32/Glycoprotein A Repetitions Predominant
Alternate Names
D11S833E, GARP, Garpin
Gene Symbol
LRRC32
Additional LRRC32/GARP Products
Product Documents for LRRC32/GARP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LRRC32/GARP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for LRRC32/GARP Antibody - BSA Free
Customer Reviews for LRRC32/GARP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LRRC32/GARP Antibody - BSA Free and earn rewards!
Have you used LRRC32/GARP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...