LSM4 Antibody (8A10) - Azide and BSA Free

Novus Biologicals | Catalog # H00025804-M01-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8A10

Format

Azide and BSA Free
View all LSM4 Primary Antibodies »

Product Specifications

Immunogen

LSM4 (NP_036453.1, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for LSM4 Antibody (8A10) - Azide and BSA Free

Western Blot: LSM4 Antibody (8A10) [H00025804-M01-100ug]

Western Blot: LSM4 Antibody (8A10) [H00025804-M01-100ug]

Western Blot: LSM4 Antibody (8A10) [H00025804-M01-100ug] - Detection against Immunogen (33.77 KDa).
ELISA: LSM4 Antibody (8A10) [H00025804-M01-100ug]

ELISA: LSM4 Antibody (8A10) [H00025804-M01-100ug]

ELISA: LSM4 Antibody (8A10) [H00025804-M01-100ug] - Detection limit for recombinant GST tagged LSM4 is 0.1 ng/ml as a capture antibody.

Applications for LSM4 Antibody (8A10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: LSM4

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Alternate Names

Glycine-rich protein, GRP, LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae), U6 snRNA-associated Sm-like protein LSm4, YER112W

Entrez Gene IDs

25804 (Human)

Gene Symbol

LSM4

OMIM

607284 (Human)

UniProt

NP_036453.1 (Human)

Additional LSM4 Products

Product Documents for LSM4 Antibody (8A10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LSM4 Antibody (8A10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LSM4 Antibody (8A10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LSM4 Antibody (8A10) - Azide and BSA Free and earn rewards!

Have you used LSM4 Antibody (8A10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies