LSM4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86846

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LSM4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LSM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human Testis shows moderate granular cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human cerevral cortex shows strong granular cycoplasmic positivity
Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody [NBP1-86846] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
LSM4 Antibody - BSA Free Immunohistochemistry-Paraffin: LSM4 Antibody - BSA Free [NBP1-86846]

Immunohistochemistry-Paraffin: LSM4 Antibody - BSA Free [NBP1-86846]

Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.

Applications for LSM4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LSM4

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Alternate Names

Glycine-rich protein, GRP, LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae), U6 snRNA-associated Sm-like protein LSm4, YER112W

Gene Symbol

LSM4

Additional LSM4 Products

Product Documents for LSM4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LSM4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LSM4 Antibody - BSA Free

Customer Reviews for LSM4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LSM4 Antibody - BSA Free and earn rewards!

Have you used LSM4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies