LYRM4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86762
![Immunocytochemistry/ Immunofluorescence: LYRM4 Antibody [NBP1-86762]](https://resources.rndsystems.com/images/products/LYRM4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86762-img0008.jpg "Immunocytochemistry/ Immunofluorescence: LYRM4 Antibody [NBP1-86762]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRD
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LYRM4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: LYRM4 Antibody [NBP1-86762]
Immunocytochemistry/Immunofluorescence: LYRM4 Antibody [NBP1-86762] - Staining of human cell line U-251 MG shows localization to nuclear bodies. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-86762]](https://resources.rndsystems.com/images/products/LYRM4-Antibody-Immunohistochemistry-Paraffin-NBP1-86762-img0001.jpg "Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-86762]")
Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-86762]
Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-86762] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.![LYRM4 Antibody - BSA Free Western Blot: LYRM4 Antibody - BSA Free [NBP1-86762]](https://resources.rndsystems.com/images/products/nbp1-86762_rabbit-polyclonal-lyrm4-antibody-30420251371461.jpg "Western Blot: LYRM4 Antibody - BSA Free [NBP1-86762]")
Western Blot: LYRM4 Antibody - BSA Free [NBP1-86762]
Analysis in control (vector only transfected HEK293T lysate) and LYRM4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Applications for LYRM4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LYRM4
Alternate Names
C6orf149LYR motif-containing protein 4, CGI-203, chromosome 6 open reading frame 149, ISD11homolog of yeast Isd11, LYR motif containing 4, mitochondrial matrix Nfs1 interacting protein
Gene Symbol
LYRM4
Additional LYRM4 Products
Product Documents for LYRM4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LYRM4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for LYRM4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LYRM4 Antibody - BSA Free and earn rewards!
Have you used LYRM4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for LYRM4 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I was wondering if the above antibody has been shown to pick up an endogenous LYRM4 protein band by western blot in human tissue samples rather than just in overexpressed cells?
A: As far as WB application is concerned, we validated the authenticity of this antibody in LYRM4 overexpression lysates only. However, this antibody does react with endogenous protein also as evidenced by ICC/IF application in human cell line U-251 MG, wherein expected nuclear positivity of LYRM4 was observed. Besides nucleus, LYRM4 localize to mitochondria also which would appear as cytoplasmic expression as evidenced by our IHC validation in human hippocampus tissues wherein this antibody detected endogenous LYRM4. This antibody's specificity was checked with protein arrays also in which it showed single peak corresponding to interaction only with its own antigen.
Loading...