M-Cadherin/Cadherin-15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57991

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all M-Cadherin/Cadherin-15 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT

Reactivity Notes

Mouse 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for M-Cadherin/Cadherin-15 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: M-Cadherin/Cadherin-15 Antibody [NBP2-57991]

Immunocytochemistry/ Immunofluorescence: M-Cadherin/Cadherin-15 Antibody [NBP2-57991]

Immunocytochemistry/Immunofluorescence: M-Cadherin/Cadherin-15 Antibody [NBP2-57991] - Staining of human cell line RH-30 shows localization to cytosol & the Golgi apparatus.

Applications for M-Cadherin/Cadherin-15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: M-Cadherin/Cadherin-15

Cadherins are a multigene family of Ca++-dependent cell adhesion molecules. They are transmembrane glycoproteins consisting of an extracellular domain, which mediates Ca++-dependent intercellular adhesion by homophilic interactions, a transmembrane region and a cytoplasmic domain. The extracellular domain is divided into a series of subdomains designated EC1-EC5. Homolgies between different members of the cadherin family are most prominent in the cytoplasmic domain and in EC1 and EC2 and much less so in EC5 of the extracellular domain and in the transmembrane region. The binding properties and specificities of the adhesive function are located in the N-terminal part of the molecules. Four members of the cadherin family have been identified and molecularly cloned from mammalian cells. These include the neuronal (N), epithelial (E), placental (P) and muscle (M) cadherins. M-cadherin is not found in fibroblasts but is expressed at low level in myoblasts and is upregulated following induction of myotube formation, suggesting a specific function in skeletal muscle cell differentiation.

Long Name

M-Cadherin [Myotubule]

Alternate Names

Cadherin-15, CDH14, CDH15, CDHM, MCAD, MCadherin

Gene Symbol

CDH15

Additional M-Cadherin/Cadherin-15 Products

Product Documents for M-Cadherin/Cadherin-15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for M-Cadherin/Cadherin-15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for M-Cadherin/Cadherin-15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review M-Cadherin/Cadherin-15 Antibody - BSA Free and earn rewards!

Have you used M-Cadherin/Cadherin-15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies