MAD2L1 Antibody (5W5U1)

Novus Biologicals | Catalog # NBP3-15384

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5W5U1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2L1 (Q13257). EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAD2L1 Antibody (5W5U1)

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384]

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384] - Western blot analysis of extracts of various cell lines, using MAD2/MAD2L1 Rabbit mAb (NBP3-15384) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for MAD2L1 Antibody (5W5U1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAD2L1

The spindle checkpoint ensures the fidelity of chromosome segregation in mitosis and meiosis. In response to defects in the mitotic apparatus, it blocks the activity of the anaphase-promoting complex, a large ubiquitin ligase required for chromosome segregation. Recent studies indicate that the spindle checkpoint monitors both the attachment of chromosomes to the mitotic spindle and the tension across the sister chromatid generated by microtubules. Upon checkpoint activation, checkpoint protein complexes containing BubR1(Mad3), Bub3, Mad2 and Cdc20 directly bind to the anaphase-promoting complex and inhibit its ligase activity. Therefore, the checkpoint proteins form a complex intracellular signalling network to inhibit the anaphase-promoting complex.

Long Name

MAD2 Mitotic Arrest Deficient-Like 1

Alternate Names

HSMAD2

Gene Symbol

MAD2L1

Additional MAD2L1 Products

Product Documents for MAD2L1 Antibody (5W5U1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAD2L1 Antibody (5W5U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAD2L1 Antibody (5W5U1)

There are currently no reviews for this product. Be the first to review MAD2L1 Antibody (5W5U1) and earn rewards!

Have you used MAD2L1 Antibody (5W5U1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...