Matrin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57359

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Matrin 3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MATR3 (matrin 3) The peptide sequence was selected from the N terminal of MATR3. Peptide sequence MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Matrin 3 Antibody - BSA Free

Western Blot: Matrin 3 Antibody [NBP1-57359]

Western Blot: Matrin 3 Antibody [NBP1-57359]

Western Blot: Matrin 3 Antibody [NBP1-57359] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate MATR3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
Immunohistochemistry: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: Matrin 3 Antibody [NBP1-57359]

Western Blot: Matrin 3 Antibody [NBP1-57359]

Western Blot: Matrin 3 Antibody [NBP1-57359] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry-Paraffin: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry-Paraffin: Matrin 3 Antibody [NBP1-57359] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Immunohistochemistry: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry: Matrin 3 Antibody [NBP1-57359]

Immunohistochemistry: Matrin 3 Antibody [NBP1-57359] - Human Heart Cellular data: Myocardial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Applications for Matrin 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Matrin 3

MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Alternate Names

distal 2, DKFZp686K0542, DKFZp686K23100, matrin 3, matrin-3, vocal cord and pharyngeal weakness with distal myopathy

Gene Symbol

MATR3

UniProt

P43243 (Human)

Additional Matrin 3 Products

Product Documents for Matrin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Matrin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Matrin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Matrin 3 Antibody - BSA Free and earn rewards!

Have you used Matrin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies