MAVS Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38704

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAVS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MAVS Antibody [NBP2-38704]

Immunocytochemistry/ Immunofluorescence: MAVS Antibody [NBP2-38704]

Immunocytochemistry/Immunofluorescence: MAVS Antibody [NBP2-38704] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human liver shows moderate granular cytoplasmic positivity in bile duct cells and hepatocytes.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human skin shows moderate granular cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human testis shows strong granular cytoplasmic positivity in leydig cells and sertoli cells.
MAVS Antibody Immunohistochemistry-Paraffin: MAVS Antibody Antibody [NBP2-38704]

Immunohistochemistry-Paraffin: MAVS Antibody Antibody [NBP2-38704]

Staining of human gastrointestinal, liver, skin and testis using NBP2-38704 (A) shows similar protein distribution across tissues to independent antibody NBP2-38613 (B).

Applications for MAVS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAVS

Double-stranded RNA viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 (MIM 603029) or by the cytoplasmic RNA helicases MDA5 (MIM 606951) and RIGI (ROBO3; MIM 608630). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK; MIM 600664) and IKKB (IKBKB; MIM 603258), which activate NFKB (see MIM 164011), or TBK1 (MIM 604834) and IKKE (IKBKE; MIM 605048), which activate IRF3 (MIM 603734). Activated IRF3 and NFKB induce transcription of IFNB (IFNB1; MIM 147640). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1; MIM 607601). For RIGI, the intermediary protein is mitochondria-bound IPS1 (Sen and Sarkar, 2005).[supplied by OMIM]

Long Name

Mitochondrial Antiviral Signaling Protein

Alternate Names

Cardif, IPS-1, VISA

Gene Symbol

MAVS

UniProt

Additional MAVS Products

Product Documents for MAVS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAVS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAVS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAVS Antibody - BSA Free and earn rewards!

Have you used MAVS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAVS Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Molecular weight of MAVS?

    A: MAVS is a 540 aa protein with a predicted size of 56 kDa.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...