MBL Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85518
Key Product Details
Validated by
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Scientific Data Images for MBL Antibody - BSA Free
Western Blot: MBL Antibody [NBP1-85518]
Western Blot: MBL Antibody [NBP1-85518] - Analysis in human liver tissue.Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518]
Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518]
Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518]
Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human cerebral cortex shows no positivity neurons as expected.Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518]
Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human prostate shows positivity in glandular cells as expected.Applications for MBL Antibody - BSA Free
Immunohistochemistry
Immunohistochemistry-Paraffin
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: MBL
Long Name
Alternate Names
Gene Symbol
Additional MBL Products
Product Documents for MBL Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MBL Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MBL Antibody - BSA Free
Customer Reviews for MBL Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MBL Antibody - BSA Free and earn rewards!
Have you used MBL Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for MBL Antibody - BSA Free
-
Q: We are working with the innate immune system of the squid Euprymna scolopes, and we are interested in characterizing the presence and patter of expression of MBL. We know that your company manufactures an antibody against MBL and we were wondering if you think that it may be used to identify the protein in the squid. I am attaching the sequence of the gene that encodes MBL in the squid as a reference for you to compare. Thanks a lot for your help. Squid C-type lectin: QDPRRHSCYYFNNATYLLSDKNLDWKETSKYCRRFHGHLPTPRNKVQVEFLSSNINWSNFNGQRYWIGLVGPSWTWSDGSPLTFANWGHKQPSPKIPGVDTCAYVNVAQQHKWEDMTCTEKKNTGA
A: I would not recommend using our product NBP1-85518 to detect your squid protein as the homology is very low.