MBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33555

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MBP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MBP Antibody - BSA Free

Western Blot: MBP Antibody [NBP2-33555]

Western Blot: MBP Antibody [NBP2-33555]

Western Blot: MBP Antibody [NBP2-33555] - Analysis in mouse cerebral cortex tissue.
Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse olfactory bulb shows immunoreactivity in processes in external plexiform layer.
Western Blot: MBP Antibody [NBP2-33555]

Western Blot: MBP Antibody [NBP2-33555]

Western Blot: MBP Antibody [NBP2-33555] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human cerebral cortex shows positivity in oligodendrocytes.
Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human hippocampus shows moderate immunoreactivity in myelinated fibers.
Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555]

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in cells in granular layer.
Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse cerebellum shows immunoreactivity in granular cell layer and in white matter.
Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse cerebral cortex shows labeling of neuronal processes in motor cortex and in corpus callosum.
Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse dorsal tenia tecta shows positivity in neuronal processes.
Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555]

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse hippocampus shows positivity in neuronal processes in the CA1 layer.

Applications for MBP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBP

Myelin Basic Protein (MBP) functions in the nervous system in myelination and is expressed in oligodendrocytes following differentiation. There are numerous isoforms generated by differential splicing events and post-translational modifications that have specialized functions. These functions include participation in signaling pathways prior to myelination, myelination or the re-myelination process following neural injury.

Long Name

Myelin Basic Protein

Alternate Names

Hmbpr, mld, shi

Gene Symbol

MBP

UniProt

P02686

Additional MBP Products

Product Documents for MBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glial Lineage Markers

Customer Reviews for MBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MBP Antibody - BSA Free and earn rewards!

Have you used MBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies