MCM3 Antibody (3E11) - Azide and BSA Free

Novus Biologicals | Catalog # H00004172-M06

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3E11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MCM3 (NP_002379, 26 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS

Specificity

MCM3 - MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) (3E11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MCM3 Antibody (3E11) - Azide and BSA Free

Western Blot: MCM3 Antibody (3E11) [H00004172-M06]

Western Blot: MCM3 Antibody (3E11) [H00004172-M06]

Western Blot: MCM3 Antibody (3E11) [H00004172-M06] - Analysis of MCM3 expression in human spleen.

Applications for MCM3 Antibody (3E11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MCM3

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq]

Alternate Names

cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB

Entrez Gene IDs

4172 (Human)

Gene Symbol

MCM3

Additional MCM3 Products

Product Documents for MCM3 Antibody (3E11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM3 Antibody (3E11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM3 Antibody (3E11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MCM3 Antibody (3E11) - Azide and BSA Free and earn rewards!

Have you used MCM3 Antibody (3E11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...