MCM3AP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58502

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCM3AP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MCM3AP Antibody [NBP2-58502]

Immunocytochemistry/ Immunofluorescence: MCM3AP Antibody [NBP2-58502]

Immunocytochemistry/Immunofluorescence: MCM3AP Antibody [NBP2-58502] - Staining of human cell line HeLa shows localization to cytosol.

Applications for MCM3AP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM3AP

The mini-chromosome maintenance (MCM) family of proteins, including MCM2, MCM3, MCM4 (Cdc21), MCM5 (Cdc46), MCM6 (Mis5) and MCM7 (Cdc47), are regulators of DNA replication that act to ensure replication occurs only once in the cell cycle. Expression of MCM proteins increases during cell growth, peaking at G1 to S phase. The MCM proteins each contain an ATP-binding motif, which is predicted to mediate ATP-dependent opening of double-stranded DNA. MCM proteins are regulated by E2F transcription factors, which induce MCM expression, and by protein kinases, which interact with MCM proteins to maintain the postreplicative state of the cell. MCM2/MCM4 complexes function as substrates for Cdc2/cyclin B in vitro. Cleavage of MCM3, which can be prevented by caspase inhibitors, results in the inactivation of the MCM complex (composed of at least MCM proteins 2

Alternate Names

80 kDa MCM3-associated protein, FLJ44336, GANPFLJ45306, human mRNA for MCM3 import factor10Protein GANP, KIAA0572MAP80germinal center-associated nuclear protein, Map80, MCM3 import protein, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein, MCM3 minichromosome maintenance deficient 3 associated protein, minichromosome maintenance complex component 3 associated protein, minichromosome maintenance deficient (S. cerevisiae) 3-associated protein, minichromosome maintenance deficient 3-associated protein

Gene Symbol

MCM3AP

Additional MCM3AP Products

Product Documents for MCM3AP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM3AP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM3AP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM3AP Antibody - BSA Free and earn rewards!

Have you used MCM3AP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...