Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00005243-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 620-709 of Human MDR1/ABCB1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Recombinant Human MDR1/ABCB1 Protein [H00005243-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00005243-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: MDR1/ABCB1

ABCB1 - ATP-binding cassette, sub-family B (MDR/TAP), member 1

Long Name

ATP-binding Cassette, Sub-family B (MDR/TAP), Member 1B

Alternate Names

ABC20, ABCB1, ABCB1B, CD243, CLCS, GP170, IBD13, PGY1

Gene Symbol

ABCB1

Additional MDR1/ABCB1 Products

Product Documents for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Customer Reviews for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human MDR1/ABCB1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human MDR1/ABCB1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?

    A: A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.

  • Q: I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.

    A:

    I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.

  • Q: I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?

    A: A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.

  • Q: I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.

    A:

    I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes