Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
Novus Biologicals | Catalog # H00005243-Q01
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
Formulation, Preparation, and Storage
H00005243-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: MDR1/ABCB1
Long Name
Alternate Names
Gene Symbol
Additional MDR1/ABCB1 Products
Product Documents for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Citations for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
Customer Reviews for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human MDR1/ABCB1 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human MDR1/ABCB1 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human MDR1/ABCB1 GST (N-Term) Protein
-
Q: I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?
A: A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.
-
Q: I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.
A:
I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.
-
Q: I am interested in MDR1 Partial Recombinant Protein (H00005243-Q01). I've noticed that this protein is partialy recombinant. Please explain what means partialy. I would also like to know if the protein is folded correctly, since the data sheet says that it shouldn't be used for experiments requiring activity. Would you be so kind and let me know, which part of MDR1 protein is partial recombinant protein you have, is it the domain which is located on the exterior surface of plasma mambrane?
A: A parital recombinant protein is made from only a part of the DNA sequence where as a Recombinant protein is made from a full DNA sequence. This protein is produced by a Taiwanese company called Abnova. It is folded correctly however we have listed it to be biologically inactive due to many customer purchasing this from Abnova and finding that it does not function correctly therefore we have suggested not to use this for any experiments requiring activity. Amino acids 620 - 709 are in the partial recombinant protein and the domain on the exterior surface has not been specified.
-
Q: I have purchased H00005243-Q01, mdr1/abcb1 purified recombinant protein. The photo indicates a KDa of around 40. Do you have the exact KDa of this product? Usually the Kda of MDR1 is 170. I am using it as a positive control in western blot and I am not getting any bands.
A:
I am sorry to learn that you used this partial recombinant protein in your WB as the positive control but did not yield any positive signal. I anticipate that your anti-human MDR1/ABCB1 antibody must bind to somewhere outside of 620 a.a. to 710 a.a. This partial protein contains only a part of the gene for human MDR1/ABCB1 (NP_000918, 620 a.a. - 710 a.a.) that is in-frame fused to a gene for the GST tag (~26 kDa) at its N-terminus. Therefore the apparent size for this partial protein is about 36 kDa, which is similar to that in the SDS-PAGE image posting on our webpage. According to "Uniprot Site", human MDR1/ABCB1 has two isoforms: isoform 1 has 1,280 a.a. with the calculated size of 141,479 Da, whereas isoform 2 has 1,216 a.a. (Mass in Da:134,032); and this is consistent with your information about the size of the protein. In summary this protein is apparently not suitable for your WB experiments as the positive control, unfortunately. The anti-human MDR1/ABCB1 antibody(ies) has to have the immunogen that is included in 620 a.a. to 710 a.a. in order for H00005243-Q01 to be useful as the positive control in WB.