ME3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05078

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ME3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1). IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ME3 Antibody - Azide and BSA Free

Western Blot: ME3 AntibodyAzide and BSA Free [NBP3-05078]

Western Blot: ME3 AntibodyAzide and BSA Free [NBP3-05078]

Western Blot: ME3 Antibody [NBP3-05078] - Analysis of extracts of various cell lines, using ME3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/ Immunofluorescence: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunocytochemistry/ Immunofluorescence: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunocytochemistry/Immunofluorescence: ME3 Antibody [NBP3-05078] - Analysis of L929 cells using ME3 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Mouse heart using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody - Azide and BSA Free [NBP3-05078]

Immunohistochemistry-Paraffin: ME3 Antibody [NBP3-05078] - Immunohistochemistry of paraffin-embedded Rat ovary using ME3 Rabbit pAb (NBP3-05078) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for ME3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ME3

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis, metastasis, and atherosclerosis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Alternate Names

EC 1.1.1, EC 1.1.1.40, FLJ34862, malate dehydrogenase, Malic enzyme 3, malic enzyme 3, NADP(+)-dependent, mitochondrial, malic enzyme, NADP+-dependent, mitochondrial, mitochondrial NADP(+)-dependent malic enzyme 3, NADP-dependent malic enzyme, mitochondrial, NADP-ME, pyruvic-malic carboxylase

Gene Symbol

ME3

Additional ME3 Products

Product Documents for ME3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ME3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ME3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ME3 Antibody - Azide and BSA Free and earn rewards!

Have you used ME3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies