MED17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57476

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MED17 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MED17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MED17 Antibody [NBP2-57476]

Immunocytochemistry/ Immunofluorescence: MED17 Antibody [NBP2-57476]

Immunocytochemistry/Immunofluorescence: MED17 Antibody [NBP2-57476] - Staining of human cell line SiHa shows localization to vesicles.

Applications for MED17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED17

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Alternate Names

Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6

Gene Symbol

MED17

Additional MED17 Products

Product Documents for MED17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MED17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED17 Antibody - BSA Free and earn rewards!

Have you used MED17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies