MED19 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87792

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MED19 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MED19. Peptide sequence: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MED19 Antibody - BSA Free

Western Blot: MED19 Antibody [NBP2-87792]

Western Blot: MED19 Antibody [NBP2-87792]

Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target Name: MED19. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml
Chromatin Immunoprecipitation: MED19 Antibody [NBP2-87792] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: MED19 Antibody [NBP2-87792]

Western Blot: MED19 Antibody [NBP2-87792]

Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target: MED19. Positive control (+): Rat testis (R-TE). Negative control (-): Rat kidney (R-KI). Antibody concentration: 1ug/ml

Applications for MED19 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED19

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activatetranscription via RNA polymerase II (Sato et al., 2003 (PubMed 12584197)).(supplied by OMIM)

Alternate Names

LCMR1mediator of RNA polymerase II transcription subunit 19, Lung cancer metastasis-related protein 1, mediator complex subunit 19DT2P1G7, mediator of RNA polymerase II transcription, subunit 19 homolog, mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)

Gene Symbol

MED19

Additional MED19 Products

Product Documents for MED19 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MED19 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED19 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED19 Antibody - BSA Free and earn rewards!

Have you used MED19 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies