Methionine Sulfoxide Reductase A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55671

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Methionine Sulfoxide Reductase A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIK

Reactivity Notes

Mouse 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Methionine Sulfoxide Reductase A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP2-55671]

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP2-55671]

Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP2-55671] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Applications for Methionine Sulfoxide Reductase A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase A

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase

Gene Symbol

MSRA

Additional Methionine Sulfoxide Reductase A Products

Product Documents for Methionine Sulfoxide Reductase A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Methionine Sulfoxide Reductase A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Methionine Sulfoxide Reductase A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Methionine Sulfoxide Reductase A Antibody - BSA Free and earn rewards!

Have you used Methionine Sulfoxide Reductase A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies