Mind Bomb 2/MIB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57751

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Mind Bomb 2/MIB2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mind Bomb 2/MIB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751]

Immunohistochemistry-Paraffin: Mind Bomb 2/MIB2 Antibody [NBP2-57751] - Staining in human skeletal muscle and heart muscle tissues using anti-MIB2 antibody. Corresponding MIB2 RNA-seq data are presented for the same tissues.

Applications for Mind Bomb 2/MIB2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mind Bomb 2/MIB2

MIB2/Skeletrophin is an actin-binding protein that bears two MIB/HERC2 domains, a ZZ-type zinc-finger domain, nine ankyrin repeats, and two RING-finger domains. The C-terminal RING domain has been found to have E3 ubiquitin ligase activity that mediates ubiquitination of the intracellular regions of the Notch receptor and its ligands to regulate Notch signaling. MIB2/Skeletrophin appears to be important to muscle development and may function as a suppressor of melanoma invasion.

Long Name

Mindbomb Homolog 2

Alternate Names

MIB2, Mind Bomb-2, Novelzin, SKD, Skeletrophin, ZZANK1, ZZZ5

Gene Symbol

MIB2

Additional Mind Bomb 2/MIB2 Products

Product Documents for Mind Bomb 2/MIB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Mind Bomb 2/MIB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
E3 Ubiquitin Ligases

Customer Reviews for Mind Bomb 2/MIB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mind Bomb 2/MIB2 Antibody - BSA Free and earn rewards!

Have you used Mind Bomb 2/MIB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies