MIST1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30979

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MIST1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MIST1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MIST1 Antibody [NBP2-30979]

Immunocytochemistry/ Immunofluorescence: MIST1 Antibody [NBP2-30979]

Immunocytochemistry/Immunofluorescence: MIST1 Antibody [NBP2-30979] - Staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining in human pancreas and skeletal muscle tissues. Corresponding BHLHA15 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human stomach shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979]

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.

Applications for MIST1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MIST1

MIST1 plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblastpopulations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. Mayalso negatively regulate bHLH-mediated t

Alternate Names

basic helix-loop-helix domain containing, class B, 8, basic helix-loop-helix family, member a15, bHLHa15, BHLHB8, class A basic helix-loop-helix protein 15, Class B basic helix-loop-helix protein 8, class II bHLH protein MIST1, MIST1MIST-1, Muscle, intestine and stomach expression 1

Gene Symbol

BHLHA15

UniProt

Q7RTS1 (Human)

Additional MIST1 Products

Product Documents for MIST1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MIST1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MIST1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MIST1 Antibody - BSA Free and earn rewards!

Have you used MIST1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies