MIXL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87808

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human MIXL1. Peptide sequence: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MIXL1 Antibody - BSA Free

Western Blot: MIXL1 Antibody [NBP2-87808]

Western Blot: MIXL1 Antibody [NBP2-87808]

Western Blot: MIXL1 Antibody [NBP2-87808] - WB Suggested Anti-MIXL1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Applications for MIXL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MIXL1

MIXL1, also known as Homeobox protein MIXL1, is a 232 amino acid protein that is 25 kDa, restricted to progenitors and secondary lymph tissues, acts as an important transcription factor in proper axial mesendoderm morphogenesis and endoderm formation, needed for efficient differentiation of cells from the primitive streak stage to blood by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages, participates in the morphogenesis of the heart and the gut during embryogenesis, and acts as a negative regulator of brachyury expression. Studies of this protein are being performed on research about uterine inversion, vascular dementia, Hodgkin's lymphoma, dementia, cholera, and hematopoiesis. OMA1 protein has been shown to interact with ALX4, DLX1, GTF2E1, IRF9, NEUROD1, NKX2-1, POU4F2, and TLE6 proteins in adipogenesis pathway and endoderm formation, hematopoietic progenitor cell differentiation, transcription, DNA-dependent, gastrulation, endoderm development, heart development, and digestive tract development processes.

Long Name

Mix1 Homeobox-like 1

Alternate Names

MILD1

Gene Symbol

MIXL1

Additional MIXL1 Products

Product Documents for MIXL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MIXL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MIXL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MIXL1 Antibody - BSA Free and earn rewards!

Have you used MIXL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies