MLC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81555

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MLC1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MLC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Analysis in human cerebral cortex and pancreas tissues using NBP1-81555 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Western Blot: MLC1 Antibody [NBP1-81555]

Western Blot: MLC1 Antibody [NBP1-81555]

Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebellum shows moderate cytoplasmic positivity in neuropil of the molecular layer.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555]

Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for MLC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MLC1

The function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an autosomal recessive neurological disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Alternate Names

LVM, megalencephalic leukoencephalopathy with subcortical cysts 1, WKL1

Gene Symbol

MLC1

Additional MLC1 Products

Product Documents for MLC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MLC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MLC1 Antibody - BSA Free

Customer Reviews for MLC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MLC1 Antibody - BSA Free and earn rewards!

Have you used MLC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies