Monkeypox Virus B6R Antibody (6U0B7)

Name: Monkeypox Virus B6R Antibody (6U0B7)
Brand: Novus Biologicals
SKU: NBP3-33487
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33487

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Monkeypox Virus Zaire-96-I-16

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6U0B7

View all Monkeypox Virus B6R Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-279 of Monkeypox Virus B6R (NP_536594.1).

Sequence:
TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Monkeypox Virus B6R Antibody (6U0B7)

Western Blot: Monkeypox Virus B6R Antibody (6U0B7) [NBP3-33487] -

Western Blot: Monkeypox Virus B6R Antibody (6U0B7) [NBP3-33487] - Western Blot analysis of recombinant Monkeypox virus Monkeypox Virus B6R Protein using Monkeypox Virus B6R Rabbit mAb at 1:2000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 1-5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 5 s.

Applications for Monkeypox Virus B6R Antibody (6U0B7)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Product Documents for Monkeypox Virus B6R Antibody (6U0B7)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Monkeypox Virus B6R Antibody (6U0B7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Monkeypox Virus B6R Antibody (6U0B7)

There are currently no reviews for this product. Be the first to review Monkeypox Virus B6R Antibody (6U0B7) and earn rewards!

Have you used Monkeypox Virus B6R Antibody (6U0B7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image