MORF4L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47370

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MORF4L2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MORF4L2 Antibody [NBP2-47370]

Immunocytochemistry/ Immunofluorescence: MORF4L2 Antibody [NBP2-47370]

Immunocytochemistry/Immunofluorescence: MORF4L2 Antibody [NBP2-47370] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370]

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370]

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells with additional cytoplasmic staining in endothelial cells and peripheral nerve/ganglion.
MORF4L2 Antibody

Western Blot: MORF4L2 Antibody [NBP2-47370] -

Western Blot: MORF4L2 Antibody [NBP2-47370] -Analysis in human cell line MCF-7.
MORF4L2 Antibody

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
MORF4L2 Antibody

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -Staining of human placenta shows strong nuclear positivity positivity in trophoblastic cells.
MORF4L2 Antibody

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -

Immunohistochemistry-Paraffin: MORF4L2 Antibody [NBP2-47370] -Staining of human testis shows strong nuclear positivity in Leydig cells and cells in seminiferous ducts.

Applications for MORF4L2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MORF4L2

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit HTATIP/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. MORF4L1 may also participate in the formation of NuA4 related complexes which lack the HTATIP/TIP60 catalytic subunit, but which include the SWI/SNF related protein SRCAP. Component of the MSIN3A histone deacetylase complex, which includes SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. MORF4L1 interacts with RB1 and MYST1. MORF4L1 may also interact with PHF12 and one or more as yet undefined members of the TLE (transducin-like enhancer of split) family of transcriptional repressors. MRGX plays a role in growth regulation and replicative senescence. Expression of MRGX, which initially increases during cell cycle, may have to decrease for cells to enter the S phase.

Alternate Names

KIAA0026MRGXProtein MSL3-2, MORFL2, MORF-related gene X protein, mortality factor 4 like 2, mortality factor 4-like protein 2, MSL3-2 protein, Transcription factor-like protein MRGX

Gene Symbol

MORF4L2

Additional MORF4L2 Products

Product Documents for MORF4L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MORF4L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MORF4L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MORF4L2 Antibody - BSA Free and earn rewards!

Have you used MORF4L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...