MOSPD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85698

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MOSPD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MOSPD3 Antibody [NBP1-85698]

Immunocytochemistry/ Immunofluorescence: MOSPD3 Antibody [NBP1-85698]

Immunocytochemistry/Immunofluorescence: MOSPD3 Antibody [NBP1-85698] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
MOSPD3 Antibody

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
MOSPD3 Antibody

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
MOSPD3 Antibody

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.
MOSPD3 Antibody

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] -

Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-85698] - Staining of human colon shows moderate nuclear positivity in glandular cells.
MOSPD3 Antibody - BSA Free Western Blot: MOSPD3 Antibody - BSA Free [NBP1-85698]

Western Blot: MOSPD3 Antibody - BSA Free [NBP1-85698]

Analysis in control (vector only transfected HEK293T lysate) and MOSPD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for MOSPD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MOSPD3

MOSPD3, also known as Motile sperm domain-containing protein 3, has 4 isoforms, a 235 amino acid isoform that is 26 kDa, a 221 amino acid isoform that is 24 kDa, a 182 amino acid isoform that is 20 kDa, and a 225 amino acid isoform that 24 kDa. Little is currently known about MOSPD3 disease involvement. This protein has been linked to heart development process.

Alternate Names

CDS3, motile sperm domain containing 3, motile sperm domain-containing protein 3, NET30

Gene Symbol

MOSPD3

Additional MOSPD3 Products

Product Documents for MOSPD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MOSPD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MOSPD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MOSPD3 Antibody - BSA Free and earn rewards!

Have you used MOSPD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...