MPDU1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84570

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MPDU1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MPDU1 Antibody [NBP1-84570]

Immunocytochemistry/ Immunofluorescence: MPDU1 Antibody [NBP1-84570]

Immunocytochemistry/Immunofluorescence: MPDU1 Antibody [NBP1-84570] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
MPDU1 Antibody

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
MPDU1 Antibody

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
MPDU1 Antibody

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
MPDU1 Antibody

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
MPDU1 Antibody - BSA Free Western Blot: MPDU1 Antibody - BSA Free [NBP1-84570]

Western Blot: MPDU1 Antibody - BSA Free [NBP1-84570]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
MPDU1 Antibody - BSA Free Western Blot: MPDU1 Antibody - BSA Free [NBP1-84570]

Western Blot: MPDU1 Antibody - BSA Free [NBP1-84570]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for MPDU1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPDU1

MPDU1 encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript.

Alternate Names

CDGIF, FLJ14836, HBeAg-binding protein 2 binding protein A, Lec35, mannose-P-dolichol utilization defect 1, mannose-P-dolichol utilization defect 1 protein, My008, PP3958, PQLC5, SL15HBEBP2BPA, Suppressor of Lec15 and Lec35 glycosylation mutation homolog

Gene Symbol

MPDU1

Additional MPDU1 Products

Product Documents for MPDU1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MPDU1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPDU1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPDU1 Antibody - BSA Free and earn rewards!

Have you used MPDU1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...