MPP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38238

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPP1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human MPP1 (NP_002427.1).

Sequence:
MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MPP1 Antibody - BSA Free

MPP1 Antibody

Western Blot: MPP1 Antibody [NBP3-38238] -

Western Blot: MPP1 Antibody [NBP3-38238] - Western blot analysis of various lysates using MPP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.

Applications for MPP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MPP1

Palmitoylated membrane protein 1 is the prototype of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. Palmitoylated membrane protein 1 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.

Alternate Names

55 kDa erythrocyte membrane protein, AAG12, EC 2.7.11, Membrane protein, palmitoylated 1, membrane protein, palmitoylated 1, 55kDa, MRG1, palmitoylated erythrocyte membrane protein, PEMPpalmitoylated 1 (55kD)

Gene Symbol

MPP1

Additional MPP1 Products

Product Documents for MPP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPP1 Antibody - BSA Free and earn rewards!

Have you used MPP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies