MPZL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57487

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPZL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MPZL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MPZL1 Antibody [NBP2-57487]

Immunocytochemistry/ Immunofluorescence: MPZL1 Antibody [NBP2-57487]

Immunocytochemistry/Immunofluorescence: MPZL1 Antibody [NBP2-57487] - Staining of human cell line HaCaT shows localization to plasma membrane, cell junctions & vesicles.

Applications for MPZL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPZL1

MPZL1, or Myelin protein zero-like protein 1, contains five isoforms that are 29 kDa, 28 kDa, 23 kDa, 16 kDa, and 12 kDa, and is involved in the process of signal transduction as a cell surface receptor. Research is currently being conducted on MPZL1 and its relation to a variety of diseases and disorders, including noonan syndrome, schizophrenia, essential hypertension, t-cell leukemia, tooth disease, and choroiditis. MPZL1 has been linked to the protein tyrosine kinase signaling pathway, and has been found to interact with PTPN11, SRC, EXOSC4, UBC, and ELAVL1.

Alternate Names

FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa

Gene Symbol

MPZL1

Additional MPZL1 Products

Product Documents for MPZL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPZL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPZL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPZL1 Antibody - BSA Free and earn rewards!

Have you used MPZL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies