MRPL19 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33795

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRPL19 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPL19 Antibody - BSA Free

Western Blot: MRPL19 Antibody [NBP2-33795]

Western Blot: MRPL19 Antibody [NBP2-33795]

Western Blot: MRPL19 Antibody [NBP2-33795] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MRPL19 Antibody [NBP2-33795]

Immunohistochemistry-Paraffin: MRPL19 Antibody [NBP2-33795]

Immunohistochemistry-Paraffin: MRPL19 Antibody [NBP2-33795] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Applications for MRPL19 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL19

Belonging to the ribosomal protein L19P family, MRPL19 plays an important role in cell translation. These Mammalian mitochondrial ribosomal proteins contain a small 28S subunit and a large 39S subunit, and consist of 75% protein to rRNA composition. The ribosomal proteins also help in protein synthesis within the mitochondrion. This gene also acts as a structural component of mitochondrial ribosomes, and encodes the 39S subunit protein. Interacting proteins include SMURF2, TRIM63, MAGEC1, MRPL12 and MRPL11. Dyslexia is also a common disease associated with the MRPL19 gene.

Alternate Names

KIAA0104L19mt, L15mt, MGC20675, mitochondrial, mitochondrial ribosomal protein L19, MRPL1539S ribosomal protein L19, mitochondrial, MRP-L15MRP-L19, RLX1, RPML15

Gene Symbol

MRPL19

UniProt

P49406 (Human)

Additional MRPL19 Products

Product Documents for MRPL19 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPL19 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL19 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL19 Antibody - BSA Free and earn rewards!

Have you used MRPL19 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies