MRPS11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30548

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS11 Antibody - BSA Free

Western Blot: MRPS11 Antibody [NBP2-30548]

Western Blot: MRPS11 Antibody [NBP2-30548]

Western Blot: MRPS11 Antibody [NBP2-30548] - Analysis in control (vector only transfected HEK293T lysate) and MRPS11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining in human thyroid gland and pancreas tissues using anti-MRPS11 antibody. Corresponding MRPS11 RNA-seq data are presented for the same tissues.
Immunohistochemistry: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry: MRPS11 Antibody [NBP2-30548] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548]

Immunohistochemistry-Paraffin: MRPS11 Antibody [NBP2-30548] - Staining of human thyroid gland shows high expression.

Applications for MRPS11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS11

MRPS11, or Mitochondrial Ribosomal Protein S11, contains a 21 kDa, a 20 kDa, and a 17 kDa isoform, and is involved in protein synthesis within the 28S small subunit of the mitochondrial ribosome. Research is currently being done on the relationship between MRPS11 and a variety of diseases and disorders, including cervical cancer, mycobacterium tuberculosis, cervicitis, tuberculosis, and pneumonia. MRPS11 is linked to the response to DNA damage and the process of translation, and interacts with ICT1, MAP1LC3A, SLX4, MRPS2, and MRPS14.

Alternate Names

28S ribosomal protein S11, mitochondrial, Cervical cancer proto-oncogene 2 protein, FLJ22512, FLJ23406, HCC-2S11mt, mitochondrial ribosomal protein S11, MRP-S11, RPMS11

Gene Symbol

MRPS11

UniProt

Additional MRPS11 Products

Product Documents for MRPS11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS11 Antibody - BSA Free and earn rewards!

Have you used MRPS11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...