MRPS31 Antibody (3J3T5)

Novus Biologicals | Catalog # NBP3-33240

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3J3T5
View all MRPS31 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665).

Sequence:
NGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKKDILKESNIQFN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MRPS31 Antibody (3J3T5)

MRPS31 Antibody (3J3T5)

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] -

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] - Western blot analysis of various lysates using MRPS31 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
MRPS31 Antibody (3J3T5)

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] -

Western Blot: MRPS31 Antibody (3J3T5) [NBP3-33240] - Western blot analysis of various lysates using MRPS31 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for MRPS31 Antibody (3J3T5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRPS31

MRPS31, also known as Mitochondrial Ribosomal Protein S31, contains a 45 kDa isoform that is 395 amino acids in length, and is involved in protein synthesis within the mitochondria. MRPS31 is not currently being utilized in disease research. The protein is not associated with any pathways or biological processes, but has been found to interact with USP42, ESR1, ITGB3BP, SLX4, and LYST.

Alternate Names

28S ribosomal protein S31, mitochondrial, IMOGN38Imogen 38, mitochondrial ribosomal protein S31, MRP-S31, S31mt

Gene Symbol

MRPS31

Additional MRPS31 Products

Product Documents for MRPS31 Antibody (3J3T5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPS31 Antibody (3J3T5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS31 Antibody (3J3T5)

There are currently no reviews for this product. Be the first to review MRPS31 Antibody (3J3T5) and earn rewards!

Have you used MRPS31 Antibody (3J3T5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies